Albumin binding raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2026-06-18. Anything still debated is marked as such rather than presented as settled.
The core sequence keeps the receptor-binding region of GHRH while replacing four positions that are vulnerable to dipeptidyl peptidase-4 and other proteases. Substitutions at positions 2, 8, 15, and 27 raise metabolic stability relative to the natural hormone. The N-terminal residues remain essential for activity, so changes there generally lower potency. Molecular weight sits near 3368 daltons for the tetrasubstituted analog without the linker, while the albumin-binding form is heavier because of the added maleimide group.
CJC-1295 is a synthetic peptide modeled on growth hormone-releasing hormone, the hypothalamic signal that prompts the pituitary to release growth hormone. Its sequence corresponds to the first twenty-nine residues of human GHRH, with four substitutions that slow enzymatic breakdown. Early descriptions placed the compound in research on growth hormone deficiency and related conditions, and later literature groups it with the long-acting GHRH analogs. The name appears in both laboratory and popular fitness writing, where it sometimes labels chemically different peptides.
Binding to GHRH receptors on pituitary somatotroph cells triggers cyclic AMP signaling and stimulates growth hormone synthesis and release. Because the peptide acts upstream of the pituitary, effects are mediated through endogenous growth hormone rather than direct receptor activation in peripheral tissues. Increases in insulin-like growth factor 1 are generally described as a downstream consequence. Most published human exposure data come from small early-stage studies, and the clinical significance of the pharmacokinetic profile remains incompletely characterized.
CJC-1295 is a synthetic analogue of growth hormone-releasing hormone, built on the 29-amino-acid GHRH(1-29) fragment. Four substitutions distinguish it from the natural sequence: D-alanine at position 2, glutamine at position 8, alanine at position 15, and leucine at position 27. These changes reduce enzymatic cleavage and extend the peptide's persistence in circulation. The compound is discussed in two forms, one carrying a drug affinity complex and one without it.
| Property | Value | Notes |
|---|---|---|
| Class | Synthetic peptide | GHRH receptor agonist |
| Sequence length | 29 amino acids | Derived from human GHRH |
| Molecular weight | About 3368 Da without linker | Albumin-binding form is heavier |
| Appearance | White to off-white lyophilized powder | Common form for research reference material |
| Typical storage | -20 °C or below, desiccated | Protect powder from light and moisture |
Laboratory handling centers on minimizing exposure to water, heat and oxygen before use. Working solutions are typically prepared in sterile water or a mild buffer, and any residual particulate matter is removed by filtration. When the powder dissolves slowly, a small proportion of acetonitrile or dilute acetic acid is sometimes added as a co-solvent. Containers are kept sealed and desiccated between uses. Records of lot number, reconstitution date and storage conditions support later comparison of results across experiments.
Identity and purity are established with reversed phase high performance liquid chromatography coupled to mass spectrometry. The chromatographic step separates the target peptide from truncated sequences and deletion products, while the mass measurement confirms the expected molecular weight to within a fraction of a dalton. Because the two common variants differ by the presence of the linker, mass alone can distinguish them in the unconjugated state. Amino acid analysis and peptide mapping are used when sequence level confirmation is required.
Lyophilized material is generally stable for extended periods when held at minus twenty degrees Celsius or below and protected from moisture and light. In solution the peptide is more labile; bond hydrolysis, aggregation and oxidation of susceptible residues all proceed faster at ambient temperature. Repeated freeze and thaw cycles should be avoided because they promote clumping and loss of soluble material. The conjugated variant adds a further consideration, since the maleimide group can hydrolyze in aqueous buffer and lose its ability to react with albumin.
Reports on this compound commonly follow serum growth hormone and insulin-like growth factor 1 across defined time windows. Protocols differ in sampling frequency, assay platform, and participant characteristics, which makes direct comparison between publications difficult. Some work focuses on pulsatile release patterns instead of average concentrations. Whether repeated exposure alters endogenous hormone rhythms over long periods remains an open question, and the formal literature is thinner than the volume of informal commentary implies.
Once in circulation, the peptide binds the growth hormone-releasing hormone receptor displayed on pituitary somatotroph cells. Receptor activation couples to Gs proteins, elevates intracellular cyclic AMP, and drives protein kinase A signaling inside the cell. That cascade increases discharge of growth hormone into the bloodstream. The analog therefore operates through a receptor pathway that already exists for the body's own releasing hormone, rather than through an engineered artificial target.
Clearance profiles diverge sharply between the two versions. The albumin-binding molecule stays in plasma for several days, whereas the unmodified analog is largely gone within about half an hour in reported work. Cleavage by dipeptidyl peptidase IV is a major contributor to the short life of the unmodified sequence. These gaps mean the two versions cannot be substituted for each other in study design or in reading results side by side.
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
== Leaders of Opposition == Official Opposition is a term used to designate the political party which has secured the second largest number of seats in the assembly. In order to get formal recognition, the party must have at least one-sixth of the total number of Members of the House as required under the aforementioned provisions. However, On 16 May 2026, the Assam Legislative Assembly amended its rules to lower the eligibility threshold for the Leader of the Opposition from one-sixth to one-tenth of the total membership. As a result, a party now requires at least 13 MLAs instead of 21 to qualify, enabling the Indian National Congress, despite its reduced strength, to appoint a Leader of the Opposition in the Assembly.
=== Hyperpyrexia === Hyperpyrexia is an extreme elevation of body temperature which, depending upon the source, is classified as a core body temperature greater than or equal to 40 or 41 °C (104 or 106 °F); the range of hyperpyrexia includes cases considered severe (≥ 40 °C) and extreme (≥ 42 °C). It differs from hyperthermia in that one's thermoregulatory system's set point for body temperature is set above normal, then heat is generated to achieve it. In contrast, hyperthermia involves body temperature rising above its set point due to outside factors. The high temperatures of hyperpyrexia are considered medical emergencies, as they may indicate a serious underlying condition or lead to severe morbidity (including permanent brain damage), or to death. A common cause of hyperpyrexia is an intracranial hemorrhage. Other causes in emergency room settings include malignant catatonia, sepsis, Kawasaki syndrome, neuroleptic malignant syndrome, drug overdose, serotonin syndrome, and thyroid storm.
Male mammals typically have rudimentary mammary glands and nipples, with a few exceptions: male mice do not have nipples, male marsupials do not have mammary glands, and male horses lack nipples. The male dayak fruit bat has lactating mammary glands. Male lactation occurs infrequently in some species. Mammary glands are true protein factories, and several labs have constructed transgenic animals, mainly goats and cows, to produce proteins for pharmaceutical use. Complex glycoproteins such as monoclonal antibodies or antithrombin cannot be produced by genetically engineered bacteria, and the production in live mammals is much cheaper than the use of mammalian cell cultures.
Docetaxel (DTX or DXL), sold under the brand name Taxotere among others, is a chemotherapy medication used to treat a number of types of cancer. This includes breast cancer, head and neck cancer, stomach cancer, prostate cancer and non-small-cell lung cancer. It may be used by itself or along with other chemotherapy medication. It is given by slow injection into a vein. Common side effects include hair loss, cytopenia (low blood cell counts), numbness, shortness of breath, nausea, vomiting, and muscle pains. Other severe side effects include allergic reactions and future cancers. Docetaxel-induced pneumotoxicity is also a well recognized adverse effect which has to be identified timely and treated after withholding the drug. Side effects are more common in people with liver problems. Use during pregnancy may harm the fetus. Docetaxel is in the taxane family of medications. It works by disrupting the normal function of microtubules and thereby stopping cell division. Docetaxel was patented in 1986 and approved for medical use in 1995. It is on the World Health Organization's List of Essential Medicines. Docetaxel is available as a generic medication.
Sources: en.wikipedia.org
=== Age-related differences === While the amino acid scores for PDCAAS and DIAAS are based on toddler requirements (1–3 year olds), the essential amino acid requirements differ for adults and infants. The most demanding essential amino acid requirements are for infants; when children become adults, they need lower proportions of essential amino acids. This also means that many of the vegan protein sources that are limited in one or more essential amino acids, are actually less deficient in essential amino acids for adults, perhaps not deficient at all. Old age and pregnancy also change amino acid requirements, because of the necessity of supporting a fetus or slowing the loss of muscle due to age. The essential amino acid requirements for infants are based on the essential amino acid proportions in human breast milk.
Production of the BG Familia mostly ended on 24 May 1994, although the 1.3 L hatchback was kept in production until October 1996 as there was originally no 1.3 L option in the following generation. In Australia and South America, the BG saloon continued to be sold until 1996 as a more affordable alternative to the newer BH model. The Indonesian market 323 was assembled locally starting in 1989 and was available only as a saloon. It was sold in a single trim called Interplay, powered by a carbureted 1.6 L SOHC engine mated to a 5-speed manual or a rare 4-speed automatic transmission. Unique to this market, the 323 came standard with a digital speedometer from the Eunos 100, a feature that was optional in Japan. Around late 1994, a special edition called Interplay Executive was introduced featuring the facelifted bumpers and bigger 14-inch steel wheels with hubcaps, but it also loses the digital speedometer. Also a few months later in this year when the newer BH model was introduced, BG model production was extended until 1997, primarily for the taxi fleet market. This fleet version had its premium features removed and an optional 1.3 L engine. In China, Haima—a joint venture between Hainan Auto Works and Mazda—began manufacturing the BG saloon on the island of Hainan in 1994. The saloon was initially marketed as the HMC6430, powered by a 1.3 L B3 engine. Another model, the GH7160, was released shortly thereafter with a 1.6 L SOHC B6 engine, manufactured at Haima's branch factory in Beihai, Guangxi.
== Diagnosis == Dwarfism is often diagnosed in childhood on the basis of visible symptoms. A physical examination can usually suffice to diagnose certain types of dwarfism, but genetic testing and diagnostic imaging may be used to determine the exact condition. In a person's youth, growth charts that track height can be used to diagnose subtle forms of dwarfism that have no other striking physical characteristics. Short stature or stunted growth during youth is usually what brings the condition to medical attention. Skeletal dysplasia is usually suspected because of obvious physical features (e.g., unusual configuration of face or shape of skull), because of an obviously affected parent, or because body measurements (arm span, upper to lower segment ratio) indicate disproportion. Bone X-rays are often key to diagnosing a specific skeletal dysplasia, but are not the sole diagnostic tool. Most children with suspected skeletal dysplasias are referred to a genetics clinic for diagnostic confirmation and genetic counseling. Since about the year 2000, genetic tests for some of the specific disorders have become available. During an initial medical evaluation of shortness, the absence of disproportion and other clues listed above usually indicates causes other than bone dysplasias.
Bukele is a proponent of Central American reunification, an ideology that calls for Costa Rica, El Salvador, Guatemala, Honduras, and Nicaragua to reestablish the Federal Republic of Central America, and has stated that Central America should be "one single nation" in some of his speeches. In January 2024, he reaffirmed on Twitter that he believes that Central America should unite as a single country; each individual country is small and lacks natural resources, but a unified Central American population and biodiversity would help strengthen the region. In his tweet, Bukele conceded that he needed "the will of the peoples" ("la voluntad de los pueblos") of Central America to unite the region. Bukele was the president pro tempore of the Central American Integration System (SICA), an economic and political organization, from 5 June to 22 December 2019. In February 2020, Bukele signed an agreement with the Guatemalan government to remove restrictions on border crossings between El Salvador and Guatemala and designate flights between the countries as "domestic" flights to promote tourism. The agreement gave Bukele's government the ability to build a port on the Caribbean Sea in Guatemalan territory, that would give El Salvador access to the Atlantic Ocean. He described the agreement as "the greatest step to the integration of Central America in the last 180 years" ("el mayor paso en la integración de Centroamérica en los últimos 180 años").
MIKES, Centre for Metrology and Accreditation, Finland, a research organisation Mikes (restaurant), a Canadian restaurant chain Mikes (surname), a surname Mikes, the Hungarian name for Miceşti village, Tureni Commune, Cluj County, Romania Mass-analyzed ion-kinetic-energy spectrometry in mass spectrometry
Sources: en.wikipedia.org
Natural GHRH is degraded quickly by dipeptidyl peptidase-4 and related enzymes, giving it a half-life measured in minutes. CJC-1295 carries substitutions that slow that breakdown, so it stays intact longer. Both act at the same pituitary receptor and produce the same class of signal.
The label was first attached to the albumin-binding form during early development work. A shorter analog without the linker later became known by the same name in informal use. Published papers normally state which version was studied, so the methods section resolves the ambiguity.
It is a synthetic peptide rather than a steroid, and it does not occur naturally in the body. Its sequence is derived from a hypothalamic hormone called growth hormone-releasing hormone. It works as a receptor agonist rather than as a replacement for that hormone.
The two share the same 29-amino-acid backbone. CJC-1295 carries an additional albumin-binding moiety that markedly extends its residence time in circulation, while the form without that moiety clears faster. Literature sometimes applies the name loosely to either variant.