The short version of lyophilized powder fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2025-10-24 and is reviewed periodically as new material appears.
CJC-1295 belongs to a class of synthetic peptides modeled on growth hormone releasing hormone, a forty-four amino acid signal produced by the hypothalamus. The compound is built from the first twenty-nine residues of the natural sequence, with four substitutions introduced at positions 2, 8, 15 and 27. These changes were designed to slow enzymatic breakdown while preserving receptor activation. The result is a peptide that is shorter than native GHRH and considerably more resistant to ordinary clearance pathways in circulation.
Two related forms appear under the CJC-1295 name. The simpler analogue, commonly written as modified GRF(1-29), carries the four substitutions but no additional conjugation. The second form attaches a maleimidopropionic acid linker to a lysine residue, a modification frequently called the drug affinity complex. That linker reacts with the free thiol on serum albumin to form a covalent bond. Because albumin has a long residence time in blood, the conjugated peptide stays in circulation far longer than the unconjugated analogue.
Receptor level activity follows the canonical GHRH pathway. The peptide binds the GHRH receptor, a class B G protein coupled receptor on somatotroph cells of the anterior pituitary. Binding raises intracellular cyclic AMP, which promotes calcium entry and the release of growth hormone into the bloodstream. Because the molecule acts at the same receptor as the endogenous hormone, its effect is superimposed on the natural pulsatile rhythm rather than replacing it. Whether sustained receptor occupation leads to desensitization is not fully settled.
The attached maleimide group explains the unusual duration of the DAC version. After injection it reacts with the thiol of cysteine-34 on serum albumin, forming a stable covalent bond. The resulting conjugate is too large for rapid kidney filtration and is shielded from many peptidases. Reported half-lives for this form reach several days, whereas the version without the group is cleared in roughly half an hour. That gap is the main pharmacological difference between the two.
Downstream of growth hormone, the liver and other tissues increase production of insulin-like growth factor 1, a mediator of many growth-promoting effects. Studies have documented elevated levels of both hormones after dosing, and the rise from the long-acting form persists longer than that produced by shorter-acting analogues. What remains unclear is whether sustained elevation of these markers translates into meaningful clinical benefit, and whether prolonged exposure carries risks that short trials could not detect.
CJC-1295 acts at the growth hormone-releasing hormone receptor, a G-protein-coupled receptor found on somatotroph cells in the anterior pituitary. Binding triggers a rise in cyclic AMP and calcium entry, which promotes release of stored growth hormone. Because the peptide mimics the body's own releasing hormone, it amplifies existing secretory pulses rather than driving continuous output. The size of the response therefore depends partly on the subject's own hormonal rhythm and feedback state.
| Property | Value | Notes |
|---|---|---|
| Peptide class | Synthetic GHRH analogue | Built on a 29 residue sequence |
| Primary target | GHRH receptor (GHRHR) | Class B G protein coupled receptor |
| Unconjugated half life | Minutes | Limited by protease degradation |
| Key modification | Four residue substitutions | Positions 2, 8, 15 and 27 |
| Common synonym | Modified GRF(1-29) | Usually denotes the form without DAC |
Binding to GHRH receptors on pituitary somatotroph cells triggers cyclic AMP signaling and stimulates growth hormone synthesis and release. Because the peptide acts upstream of the pituitary, effects are mediated through endogenous growth hormone rather than direct receptor activation in peripheral tissues. Increases in insulin-like growth factor 1 are generally described as a downstream consequence. Most published human exposure data come from small early-stage studies, and the clinical significance of the pharmacokinetic profile remains incompletely characterized.
CJC-1295 is a synthetic analogue of growth hormone-releasing hormone, built on the 29-amino-acid GHRH(1-29) fragment. Four substitutions distinguish it from the natural sequence: D-alanine at position 2, glutamine at position 8, alanine at position 15, and leucine at position 27. These changes reduce enzymatic cleavage and extend the peptide's persistence in circulation. The compound is discussed in two forms, one carrying a drug affinity complex and one without it.
The drug affinity complex is a maleimidopropionic acid group attached to a lysine side chain. It reacts with the free thiol of cysteine-34 on circulating albumin, forming a covalent bond. This conjugation keeps the peptide in the bloodstream and shields it from rapid renal filtration and proteolysis. Reported circulation half-lives for the albumin-bound form fall in the range of roughly six to nine days in early human studies.
Two related forms circulate in technical discussion under the same family name. The original version carries a drug affinity complex (DAC) that binds covalently to serum albumin after administration, and this linkage substantially extends circulation time. A second form, frequently written as modified GRF(1-29) or CJC-1295 without DAC, lacks that linker and clears much faster. The naming is a frequent source of confusion because the shorthand CJC-1295 can refer to either form depending on the source. Reports sometimes fail to specify which variant was studied.
The peptide backbone includes a D-alanine at position two, which resists cleavage by dipeptidyl peptidase IV, and several other substitutions that reduce degradation. Its molecular weight is roughly 3.4 kDa without the linker and about 3.6 kDa with it. The molecule is water soluble and is normally supplied as a lyophilized powder. Precise sequence and mass values depend on which variant is described, so technical documents usually state the exact form being referenced.
The human endoglin gene is located on human chromosome 9 with location of the cytogenic band at 9q34.11. Endoglin glycoprotein is encoded by 39,757 bp and translates into 658 amino acids. The expression of the endoglin gene is usually low in resting endothelial cells. This, however, changes once neoangiogenesis begins and endothelial cells become active in places like tumor vessels, inflamed tissues, skin with psoriasis, vascular injury and during embryogenesis. The expression of the vascular system begins at about 4 weeks and continues after that. Other cells in which endoglin is expressed consist of monocytes, especially those transitioning into macrophages, low expression in normal smooth muscle cells, high expression vascular smooth muscle cells and in kidney and liver tissues undergoing fibrosis.
Ethylhexyl palmitate, also known as octyl palmitate, is the fatty acid ester derived from 2-ethylhexanol and palmitic acid. It is frequently utilized in cosmetic formulations. Ethylhexyl palmitate is a branched saturated fatty ester derived from ethylhexyl alcohol and palmitic acid. Ethylhexyl palmitate is a clear, colorless liquid with a slightly fatty odor at room temperature. The ester is synthesized by reacting palmitic acid and 2-ethylhexanol in the presence of an acid catalyst. Ethylhexyl palmitate is used in cosmetic formulations as a solvent, carrying agent, pigment wetting agent, fragrance fixative and emollient. Its dry-slip skinfeel is similar to some silicone derivatives.
46. Int J Pharm Compd. 2026 Jul-Aug;30(4):329-336. Synthetic Peptides in Pharmacy Compounding: Analysis of PCAC Recommendations and Industry Safety Standards. Willis J(1), Vu N(2)(3). Author information: (1)University of Oklahoma College of Pharmacy. (2)ARL Bio Pharma, Oklahoma City, Oklahoma. Nvu@arlok.com. (3)University of Oklahoma College of Pharmacy, Oklahoma City, Oklahoma. Compounded peptides have quickly moved from a niche topic to a growing area of interest among patients and prescribers. These products are promoted for a wide range of uses, including tissue repair, inflammation, metabolic health, and healthy aging. This article examines the proposed uses of these peptides, the concerns raised during the review, and the practical implications for compounders. Copyright© by International Journal of Pharmaceutical Compounding, Inc.
Antimony (51Sb) occurs naturally as two stable isotopes, 121Sb (57.21%) and 123Sb (42.79%). There are 37 artificial radioactive isotopes known with mass numbers 104 to 142, the lightest two of which (104-105Sb) are beyond the proton drip line. Isotopes that are lighter than the stable isotopes tend to decay by β+, and those that are heavier tend to decay by β−; the intermediate 122Sb is observed to decay in both ways. The longest-lived radioisotopes of antimony are: the minor fission product 125Sb, with a half-life of 2.758 years; 124Sb, with half-life 60.20 days; and 126Sb, with half-life 12.35 days. All other isotopes have half-lives less than 4 days, most less than an hour. Of the numerous isomers reported, the longest-lived is 120m1Sb with half-life 5.76 days; this nuclide has not been confirmed not to be the ground state.
Sources: en.wikipedia.org
Our goals are to fulfil our people's democratic aspirations in keeping with the Arab Spring movement." In an interview with Yemen Times, Hussein al-Bukhari, a Houthi insider, said that Houthis' preferable political system is a republic with elections where women can also hold political positions, and that they do not seek to form a cleric-led government after the model of Islamic Republic of Iran, for "we cannot apply this system in Yemen because the followers of the Shafi (Sunni) doctrine are bigger in number than the Zaydis". In 2018, the Houthi leadership proposed the establishment of a non-partisan transitional government composed of technocrats. Ali Akbar Velayati, International Affairs Advisor to Iranian Supreme Leader Ayatollah Ali Khamenei, stated in October 2014 that "We are hopeful that Ansar-Allah has the same role in Yemen as Hezbollah has in eradicating the terrorists in Lebanon". Mohammed al-Houthi criticized the Trump-brokered Abraham Accords between Israel and the United Arab Emirates as "betrayal" against the Palestinians and the cause of pan-Arabism.
The exterior of an individual segment is a thin cuticle over the skin, commonly pigmented red to brown, which has specialized cells that secrete mucus over the cuticle to keep the body moist and ease movement through the soil. Under the skin is a layer of nerve tissue, and two layers of muscles—a thin outer layer of circular muscle, and a much thicker inner layer of longitudinal muscles. Interior to the muscle layer is a fluid-filled chamber called a coelom that by its pressurization provides structure to the worm's boneless body. The segments are separated from each other by septa (the plural of "septum") which are perforated transverse walls, allowing the coelomic fluid to pass between segments. A pair of structures called nephrostomes are located at the back of each septum; a nephric tubule leads from each nephrostome through the septum and into the following segment. This tubule then leads to the main body fluid filtering organ, the nephridium or metanephridium, which removes metabolic waste from the coelomic fluid and expels it through pores called nephridiopores on the worm's sides; usually, two nephridia (sometimes more) are found in most segments. At the centre of a worm is the digestive tract, which runs straight through from mouth to anus without coiling, and is flanked above and below by blood vessels (the dorsal blood vessel and the ventral blood vessel as well as a subneural blood vessel) and the ventral nerve cord, and is surrounded in each segment by a pair of pallial blood vessels that connect the dorsal to the subneural blood vessels.
NADH + H+ + acceptor ⇌ NAD+ + reduced acceptor NADH dehydrogenase is a flavoprotein that contains iron-sulfur centers. There are two main enzymes often referred to as NADH dehydrogenase, both involving a quinone as an acceptor. NADH dehydrogenase (H(+)-translocating), also known as Complex I (EC 7.1.1.2) is an proton pump which is part of the electron transport chain which is vital for ATP production in eukaroyotes. The other type, NADH dehydrogenase (non-energetic) (EC 1.6.5.9) refers to an enzyme found in yeast, plants, and some aerobic bacteria that catalyzes a similar reaction, but without pumping protons.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP.
Ab initio quantum mechanical methods simulate liquids using only the laws of quantum mechanics and fundamental atomic constants. In contrast with classical molecular dynamics, the intermolecular force fields are an output of the calculation, rather than an input based on experimental measurements or other considerations. In principle, ab initio methods can simulate the properties of a given liquid without any prior experimental data. However, they are very expensive computationally, especially for large molecules with internal structure.
Sources: en.wikipedia.org
The names are often used interchangeably in casual writing, but they are not strictly identical. Modified GRF(1-29) refers to the unconjugated analogue carrying only the four substitutions. The version sold as CJC-1295 with DAC includes the albumin binding linker and clears much more slowly.
DAC stands for drug affinity complex, a term describing the maleimidopropionic acid linker. This group forms a covalent bond with the cysteine residue on serum albumin after administration. The resulting adduct is what extends the circulating half life from minutes to days.
No. It is entirely synthetic and does not correspond to any known endogenous peptide. The design starts from human growth hormone releasing hormone and introduces deliberate substitutions. Any biological effect comes from mimicking the natural hormone at its receptor.
It binds the growth hormone-releasing hormone receptor on pituitary somatotroph cells. Receptor activation raises cyclic AMP and promotes release of stored growth hormone granules. Because the peptide persists longer than natural releasing hormone, stimulation is prolonged rather than brief.