A practical reference on DAC: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2025-09-13. Anything still debated is marked as such rather than presented as settled.
CJC-1295 is a synthetic peptide designed to mimic growth hormone-releasing hormone (GHRH), the endogenous signal that prompts the pituitary gland to release growth hormone. The compound is a modified fragment of the natural hormone, spanning the first twenty-nine amino acids of GHRH with several substitutions that slow enzymatic breakdown. Two variants circulate in research settings: one carrying a drug affinity complex (DAC) and one without it. The DAC-free form is frequently labelled Mod GRF(1-29) in catalogs and discussion forums.
The peptide binds GHRH receptors on somatotroph cells within the anterior pituitary, triggering a signalling cascade that increases growth hormone secretion. Its improved resistance to dipeptidyl peptidase IV degradation distinguishes it from the parent hormone. In the DAC-bearing version, a maleimide group reacts with a cysteine residue on serum albumin, forming a covalent bond that keeps the peptide in circulation far longer. That albumin attachment is the central design feature separating the two research variants.
The dividing feature between the two forms is a maleimide-based drug affinity complex, abbreviated DAC. In the DAC-bearing version, a linker attaches the peptide to serum albumin after administration, and that association slows removal from plasma. The version lacking DAC appears in catalogs as MOD GRF(1-29) or tetrasubstituted GRF(1-29). Because informal writing treats both as one item, comparisons drawn from such sources routinely blend measurements taken from two molecules with substantially different behavior.
Four amino acid substitutions separate the modified backbone from the parent GRF(1-29) sequence. These changes reduce recognition by dipeptidyl peptidase IV and related proteases, extending the interval before degradation. Development work in this area sought longer-acting GHRH analogs for endocrine investigation. Published descriptions treat the substitution set as a defining property of the core sequence, while the albumin-binding linker is described separately as an optional addition to that same backbone.
CJC-1295 is a synthetic peptide analog of growth hormone-releasing hormone, constructed on the 29-amino-acid fragment designated GRF(1-29). The name began as an internal development code during the 1990s and later spread through research supply catalogs and discussion forums. The molecule does not occur in nature; its sequence is engineered rather than isolated from tissue. Two related compounds are sold under this single label, and they differ by one appended chemical group that strongly influences how long the peptide remains in circulation.
| Property | Value | Notes |
|---|---|---|
| Molecular weight (with DAC) | ~3647 Da | Calculated from the full amino acid sequence |
| Molecular weight (without DAC) | ~3368 Da | Mod GRF(1-29) variant |
| Appearance | White lyophilized powder | Typical form supplied for research |
| Solubility | Soluble in water | Dissolves in aqueous buffers |
| Receptor target | GHRH receptor | Expressed on pituitary somatotroph cells |
Much to the dismay of comedy club owners booking him, he began abandoning trademark celebrity impressions, opting instead to try adding observational and character humor to his comedic repertoire, a process that often involved forcing himself to improvise and scramble in front of dissatisfied live audiences that came to see him do impressions. From 1990 to 1994, Carrey was a regular cast member of the ensemble comedy television series In Living Color. The popularity of the series helped him to land his first few major film roles.
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
As well as with dim sum, many Chinese drink their tea with snacks such as nuts, plums, dried fruit (in particular jujube), small sweets, melon seeds, and waxberry. China was the earliest country to cultivate and drink tea, which is enjoyed by people from all social classes. Tea processing began after the Qin and Han dynasties. The different types of Chinese tea include red (known as "black tea" outside of East Asia), white, green, yellow, oolong, and black (often called "dark tea" in English to differentiate it from "black tea"). Chinese tea is often classified into several different categories according to the variety of the tea plant from which it is sourced, the region in which it is grown, and the method of production used. Flavored and scented teas originated in China. Jasmine, osmanthus, chrysanthemum, and ginseng are popular varieties. Historically, compressed tea dominated and powdered tea known as matcha would be made from it. This was later supplanted by loose-leaf tea. Fermented tea drinks like kombucha are believed to originate in China, but kombucha is now better known outside of China than within the country. There are four major tea plantation regions: Jiangbei, Jiangnan, Huanan and the southwestern region. Well known types of green tea include Longjing, Huangshan Maofeng, Bilochun, Putuofeng Cha, and Liu'an Guapian. China is the world's largest exporter of green tea. One of the most ubiquitous accessories in modern China, after a wallet or purse and an umbrella, is a double-walled insulated glass thermos with tea leaves in the top behind a strainer.
=== Evolutionary rate === For sequence evolution, dN/dS analysis studies often indicate that de novo genes evolve at a higher rate compared to other genes. For expression evolution and structural evolution, quantitative studies across different evolutionary ages or phylostratigraphic branches are very few.
Sources: en.wikipedia.org
Under conditions of low oxygen concentration in the bloodstream, such as exercise, stress, altitude, or dehydration, HbS polymerisation forms fibrous precipitates within the red blood cell. In people homozygous for the sickle cell mutation, the presence of long-chain polymers of HbS distort the shape of the red blood cell from a smooth, doughnut-like shape to the sickle shape, making it fragile and susceptible to blocking or breaking within capillaries. In people heterozygous for HbS (carriers of sickle cell disease), the polymerisation problems are minor because the normal allele can produce half of the haemoglobin. Sickle cell carriers have symptoms only if they are deprived of oxygen (for example, at altitude) or while severely dehydrated.
Hanning (1958), professor of English literature at Columbia University Neil Harris (1958), professor of art history at the University of Chicago Joachim Neugroschel (1958), prolific multilingual translator David Rothman (1958), professor of social medicine and president of the Institute on Medicine as a Profession John Clubbe (1959), professor of English at the University of Kentucky Benjamin Cohen (1959), political economist and authority on International political economy Richard Fremantle (1959), Anglo-American art historian, son of writer Anne Fremantle Robert Nozick (1959), libertarian philosopher known for his book Anarchy, State, and Utopia Isser Woloch (1959), historian of the French Revolution Arnold A. Offner (1959), professor of history at Lafayette College and past president of Society for Historians of American Foreign Relations Riordan Roett (1959), political scientist and Latin American specialist at Johns Hopkins University Bruce M.
=== California === In 2001, California enacted phlebotomy licensure following a public health outcry about an on-the-job trained phlebotomist that re-used needles. California has two levels of phlebotomy licensure:
Sources: en.wikipedia.org
Dominion Voting Systems announces that they have sued Fox Corporation and Fox Broadcasting Company, the parent company of Fox News, for defamation and for failing to preserve documents relating to the role Rupert Murdoch played in spreading false claims about Dominion. November 9 – The South Dakota Legislature votes to consider the impeachment of Attorney General Jason Ravnsborg. November 11 – Vice President Harris travels to Paris to deliver a speech at the Paris Peace Forum. November 12 – United States Attorney General Merrick Garland announces that former White House Chief Strategist Steve Bannon has been charged by the Department of Justice for refusing to testify to the January 6 select committee investigating the Capitol riot and refusing to provide documents requested by the committee. Bannon turned himself in to the FBI three days later. November 13 – While speaking before a "ReAwaken America" audience in November 2021, Former Trump National Security Advisor Michael Flynn said, "If we are going to have one nation under God, which we must, we have to have one religion. One nation under God, and one religion under God." causing some outrage. November 15 Radio host and conspiracy theorist Alex Jones is found liable for damages in lawsuits brought by parents of children killed in the Sandy Hook elementary school shooting, over Jones's false claim the massacre was a hoax. President Biden signs the Infrastructure Investment and Jobs Act into law. November 16 – Maryland reports their first case of monkeypox in a resident who traveled from Nigeria. November 17 – The U.S.
Thin-layer chromatography (TLC) is a widely employed laboratory technique used to separate different biochemicals on the basis of their relative attractions to the stationary and mobile phases. It is similar to paper chromatography. However, instead of using a stationary phase of paper, it involves a stationary phase of a thin layer of adsorbent like silica gel, alumina, or cellulose on a flat, inert substrate. TLC is very versatile; multiple samples can be separated simultaneously on the same layer, making it very useful for screening applications such as testing drug levels and water purity. Possibility of cross-contamination is low since each separation is performed on a new layer. Compared to paper, it has the advantage of faster runs, better separations, better quantitative analysis, and the choice between different adsorbents. For even better resolution and faster separation that utilizes less solvent, high-performance TLC can be used. An older popular use had been to differentiate chromosomes by observing distance in gel (separation of was a separate step).
==== Specialised mammalian serpins ==== Many mammalian serpins have been identified that share no obvious orthology with a human serpin counterpart. Examples include numerous rodent serpins (particularly some of the murine intracellular serpins) as well as the uterine serpins. The term uterine serpin refers to members of the serpin A clade that are encoded by the SERPINA14 gene. Uterine serpins are produced by the endometrium of a restricted group of mammals in the Laurasiatheria clade under the influence of progesterone or estrogen. They are probably not functional proteinase inhibitors and may function during pregnancy to inhibit maternal immune responses against the conceptus or to participate in transplacental transport.
A 1968 study reported that over one-third of Puerto Rican women were not aware that tubal ligation was permanent or irreversible. Some doctors did not even request consent while other doctors threatened to not deliver the baby right before delivery unless the mother consented to sterilization after birth. If mothers were receiving government assistance, many women were threatened to have their welfare terminated. Additionally, the U.S. government and institutions worked collaboratively to incentivize sterilizations. Many doctors and hospital administrators began to encourage sterilizations due to the fact that the Joint Committee for Hospital Accreditation refused to accredit hospitals in Puerto Rico "unless a ten percent limit of sterilization (in proportion to all hospital deliveries) was agreed upon". In the 1930s, Puerto Rican women began to occupy jobs within factories. The women working in these factories felt an immense amount of pressure to undergo a sterilization to prove to employers that their pregnancy would not deter them from completing their job. This same year, approximately three sugar plantations housed birth control clinics and discriminated against women that were not sterilized as they refused employment to women who would not get the procedure. Puerto Rican women on sugar plantations were discriminated against while others were incentivized to alter their reproductive capacity to become the ideal responsible and dependable female worker.
Sources: en.wikipedia.org
The synthetic peptide keeps the receptor-binding region of GHRH but carries substitutions that resist enzymatic cleavage. In the DAC version, an added group also anchors the molecule to albumin, extending its presence in the bloodstream.
The maleimide group forms a covalent link with albumin, an abundant blood protein. This attachment slows clearance, so a single administration persists much longer than the unmodified peptide. The feature is the main reason the two variants are handled differently in study design.
It is not an approved therapeutic product in major regulatory jurisdictions. It appears in research chemical catalogs and scientific literature rather than pharmacy shelves. Clinical development was limited and did not reach approval.
No. It is a laboratory-synthesized analog built on a fragment of the natural hormone. The natural peptide is shorter-lived and lacks the stabilizing substitutions found in the synthetic version.