Everything below concerns albumin binding. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2026-08-01. Numbers and descriptions here follow the published literature rather than marketing material.
The peptide binds GHRH receptors on somatotroph cells within the anterior pituitary, triggering a signalling cascade that increases growth hormone secretion. Its improved resistance to dipeptidyl peptidase IV degradation distinguishes it from the parent hormone. In the DAC-bearing version, a maleimide group reacts with a cysteine residue on serum albumin, forming a covalent bond that keeps the peptide in circulation far longer. That albumin attachment is the central design feature separating the two research variants.
Pharmacokinetic behaviour differs sharply between the two forms. The DAC-bearing peptide shows an extended circulation time measured in days, whereas the version without the complex is cleared within roughly half an hour. This gap shapes how researchers design dosing schedules in animal models. Whether the prolonged presence of the DAC form produces effects meaningfully different from the short-acting variant remains an open question, since comparative human data are scarce.
Laboratory handling centers on minimizing exposure to water, heat and oxygen before use. Working solutions are typically prepared in sterile water or a mild buffer, and any residual particulate matter is removed by filtration. When the powder dissolves slowly, a small proportion of acetonitrile or dilute acetic acid is sometimes added as a co-solvent. Containers are kept sealed and desiccated between uses. Records of lot number, reconstitution date and storage conditions support later comparison of results across experiments.
Identity and purity are established with reversed phase high performance liquid chromatography coupled to mass spectrometry. The chromatographic step separates the target peptide from truncated sequences and deletion products, while the mass measurement confirms the expected molecular weight to within a fraction of a dalton. Because the two common variants differ by the presence of the linker, mass alone can distinguish them in the unconjugated state. Amino acid analysis and peptide mapping are used when sequence level confirmation is required.
| Property | Value | Notes |
|---|---|---|
| Molecular weight (with DAC) | ~3647 Da | Calculated from the full amino acid sequence |
| Molecular weight (without DAC) | ~3368 Da | Mod GRF(1-29) variant |
| Appearance | White lyophilized powder | Typical form supplied for research |
| Solubility | Soluble in water | Dissolves in aqueous buffers |
| Receptor target | GHRH receptor | Expressed on pituitary somatotroph cells |
Two forms circulate in research settings and are frequently confused. One carries the drug affinity complex and is often written as CJC-1295 with DAC; the other lacks that group and is usually called modified GRF(1-29). The two share the same core sequence but differ sharply in how long they persist in blood. Products labelled only as CJC-1295 normally refer to the version carrying the complex. Documentation that omits the distinction leaves the intended molecule ambiguous.
CJC-1295 is a synthetic peptide built as a long-acting analogue of growth hormone-releasing hormone. Its backbone matches the first twenty-nine residues of the natural human hormone, with four amino acid substitutions added to slow enzymatic breakdown. A reactive maleimide group, commonly termed the drug affinity complex, allows the peptide to attach to circulating albumin after administration. That albumin attachment keeps the molecule in the bloodstream for an extended period instead of being cleared within minutes.
Naming in this area is inconsistent, and readers should treat product labels with care. In much of the literature and in vendor catalogs, the unqualified term refers to the albumin-binding version, while the version lacking the DAC group appears as modified GRF(1-29), mod GRF(1-29), or the same name with a without-DAC qualifier. Because one abbreviation has been applied to both materials, the only reliable way to identify a sample is to check the stated sequence and the presence of the linker.
CJC-1295 is the name used for a synthetic peptide modeled on growth hormone-releasing hormone, the hypothalamic signal that prompts the pituitary to release growth hormone. The compound was described by a Canadian drug discovery company in the mid-2000s as a long-acting research tool. Two closely related molecules share the name in practice: one carries a drug affinity complex, or DAC, group, and one does not. The distinction matters because the two behave differently in circulation.
The peptide backbone corresponds to GRF(1-29), the first 29 residues of native growth hormone-releasing hormone, which retains most of the receptor-activating activity of the full-length molecule. Four substitutions distinguish the analog from the natural sequence: D-alanine at position 2, glutamine at position 8, alanine at position 15, and leucine at position 27. These changes slow cleavage by dipeptidyl peptidase IV, the enzyme that degrades native hormone in plasma within minutes. The outcome is improved enzymatic stability combined with a still brief residence time when no additional modification is present.
Analytical confirmation usually relies on reversed-phase high-performance liquid chromatography for purity and on liquid chromatography coupled to mass spectrometry for identity. Mass data reveal the expected molecular mass and can flag truncated or oxidized species. Amino acid analysis and peptide mapping provide sequence-level verification. Immunoassays are used in some biological matrices, but antibodies raised against one releasing-hormone analog may cross-react with another. Reported purity figures depend heavily on the method used, so comparisons between suppliers require matching the analytical approach.
The two variants differ dramatically in how long they persist in circulation. The form lacking the albumin-binding group has a plasma half-life measured in tens of minutes, comparable to the natural hormone fragment. The version carrying the drug affinity complex binds albumin and shows a half-life of roughly six to eight days in human studies. That figure comes from small trials that tracked hormone levels over extended periods. The physiological consequences of sustained versus pulsatile stimulation are still debated and the literature does not settle the point.
Lyophilized peptide powder is comparatively stable when kept dry, cold, and protected from light. Once dissolved, the molecule is vulnerable to deamidation, oxidation, and aggregation, with the rate depending on pH, buffer composition, and temperature. Alkaline conditions and repeated freeze-thaw cycles accelerate loss of the intact peptide. The methionine present in the native sequence is a known oxidation site, which is one reason it was replaced in the modified fragment. Suppliers typically recommend cold storage of solutions and use within a short window.
Cooling preserves food by slowing down the growth and reproduction of microorganisms and the action of enzymes that causes the food to rot. The introduction of commercial and domestic refrigerators drastically improved the diets of many in the Western world by allowing food such as fresh fruit, salads and dairy products to be stored safely for longer periods, particularly during warm weather. Before the era of mechanical refrigeration, cooling for food storage occurred in the forms of root cellars and iceboxes. Rural people often did their own ice cutting, whereas town and city dwellers often relied on the ice trade. Today, root cellaring remains popular among people who value various goals, including local food, heirloom crops, traditional home cooking techniques, family farming, frugality, self-sufficiency, organic farming, and others.
Furikake (振り掛け, ふりかけ, 振掛け, 振掛) is a dry Japanese condiment sprinkled on top of cooked rice, or used as an ingredient in onigiri. It typically consists of a mixture of dried fish or freeze-dried eggs, sesame seeds, dried seaweed flakes, sugar, and salt. Other ingredients, such as katsuobushi (sometimes indicated on the package as bonito), okaka (bonito flakes moistened with soy sauce and dried again), freeze-dried salmon particles, shiso, egg, powdered miso, or vegetables, are often added. Furikake is often brightly colored and flaky. It can have a slight fish or seafood flavoring and may be spicy or sweet. It can be used in Japanese cooking for pickling and for rice balls (onigiri).
Rennie, the British commissioner in Allenstein, reported on 11 March 1920, that "in those parts which touch the Polish frontier a vigorous German propaganda is in progress" and that "the Commission is doing all it can to prevent German officials in the district from taking part in national propaganda in connection with the Plebiscite. Ordinances and instructions in this sense have been issued".
In series 3, Kenny is said to have helped Eric through a drinking problem following Eric's marital separation. Kenny also reveals he recently got married himself. Eric admits to Yasmin that he regrets showing Kenny a vulnerable side of himself. Eric, recently promoted to partner, is told by Adler that he needs to fire someone on the trading floor to prove his worth. Instead of firing Yasmin or Robert like he initially considered, Eric fires Kenny, threatening to expose his past treatment of Yasmin if he does not go quietly. Kenny is later shown to have joined Goldman Sachs alongside fellow ex-Pierpoint employees Daria Greenock and Jackie Walsh, and the three agree to help Harper short Pierpoint. In series 4, Kenny now works at Deutsche Bank, and Harper and Eric, now running their own hedge fund, enlist him to broker their short of payment processing startup Tender. Eric apologizes to Kenny for firing him. Kenny later tells Harper and Eric that they have breached their risk limits due to Tender's share price continuing to rise, forcing Deutsche to issue a margin call on their firm. Harper liquidates several of her firm's other positions to post more collateral, and sends Sweetpea and Kwabena to Accra in a last-ditch effort to uncover evidence against Tender. The Tender short is ultimately successful, and Harper calls Kenny to close the position after Tender's stock plummets, netting SternTao £110 million.
Rock salt has been mined at Lake Afrera, and the surrounding part of the Afar Depression, for centuries. Lt. Lefebvre recorded some of the hazards of mining salt from the Depression, which he heard from one of the miners himself:
Sources: en.wikipedia.org
== Video games == Half-Life (series), a video game series developed by Valve Half-Life (video game), the first game in the series Half-Life: Blue Shift, expansion to Half-Life Half-Life: Opposing Force, expansion to Half-Life Half-Life: Decay, multiplayer expansion to Half-Life Half-Life 2, the second game in the series Half-Life 2: Lost Coast, expansion to Half-Life 2 that happens somewhere in-between chapters of Half-Life 2 Half-Life 2: Episode One, a shorter game following the events of Half-Life 2 Half-Life 2: Episode Two, a shorter game following the events of Episode One Half-Life: Alyx, a prequel to the events in Half-Life 2
== Requirements == The formal requirements to begin gender-affirming hormone therapy vary widely depending on geographic location and specific institution. Gender-affirming hormones can be prescribed by a wide range of medical providers including, but not limited to, primary care physicians, endocrinologists, and gynecologists. Requirements to be prescribed these hormones generally include a minimum age. According to the Endocrine Society, there has been little research on taking cross-sex hormones before the age of about 14. Historically, many health centers required a psychiatric evaluation and/or a letter from a therapist before beginning hormone replacement therapy. Many centers now use an informed consent model that does not require any routine formal psychiatric evaluation, but rather focuses on reducing barriers to care while ensuring a person can understand the risks and benefits of treatment. Some LGBT health organizations, including Chicago's Howard Brown Health Center and Planned Parenthood, advocate for this type of informed consent model. The World Professional Association for Transgender Health (WPATH) Standards of Care, 7th edition, note that both of these approaches to care are appropriate.
Negros is the second largest island in the Visayas (after Samar) and the fourth largest of the Philippines, with a total land area of 13,309.6 square kilometres (5,138.9 sq mi), similar to Flores or Jamaica. It is located between the islands of Panay and Guimaras to the west and Cebu to the east, with Siquijor located on the toe of the island and the islands of Bantayan to the north. Politically and linguistically, Negros is divided into two provinces: Negros Occidental and Negros Oriental. This division of the island, which roughly follows the mountain range in the center of the island, corresponds to the two related linguistic groups. The western half (Occidental) is home to the Hiligaynon Visayan-speaking population while the eastern half (Oriental) is home to the Cebuano Visayan-speaking population. Together, they are all called Negrenses. Kanlaon Volcano, located in the central-northern part of the island is the third most-active volcano in the Philippines and overlooks bordering communities and the city of Bacolod to the west. It is the highest peak of the whole island and of the Visayas. Other notable peaks on the island are Mount Silay and Mount Mandalagan in Negros Occidental and Mount Talinis (also known as Cuernos de Negros) in Negros Oriental. There are also lakes that dot the island, among the most notable are the Balinsasayao Twin Lakes in Negros Oriental. The volcanic activity in Negros is harnessed into electricity through two geothermal power plants in the island.
Octopus vulgaris grows to 25 cm (10 inches) in mantle length with arms up to 1 m (3.3 feet) long. It lives for 1–2 years and may weigh up to 9 kg (20 pounds). Mating may become cannibalistic. O. vulgaris is caught by bottom trawls on a huge scale off the northwestern coast of Africa. More than 20,000 tonnes (22,000 short tons) are harvested annually. The common octopus hunts at dusk. Crabs, lobsters, and bivalve mollusks (such as cockles) are preferred, although the octopus eats almost anything it can catch. It is able to change colour to blend in with its surroundings, and is able to jump upon any unwary prey that wanders across its path. Using its beak, it is able to break into the shells of shelled mollusks. It also possesses venom to subdue its prey. They have evolved to have large nervous systems and brains. An individual has about 500 million neurons in its body, almost comparable to dogs. They are intelligent enough to distinguish brightness, navigate mazes, recognize individual people, learn how to unscrew a jar or raid lobster traps. They have also been observed keeping "gardens", in which they collect various marine plant life and algae, alongside collections of shells and rocks; this behavior may have inspired the 1969 Beatles title, "Octopus' Garden". O. vulgaris was the first invertebrate animal protected by the Animals (Scientific Procedures) Act 1986 in the UK. Training experiments have shown the common octopus can distinguish the brightness, size, shape, and horizontal or vertical orientation of objects.
The BBC reports that security is to be increased at Champions League games, following threats from a pro-IS media channel. Foreign Secretary David Cameron confirms that the UK will not suspend the sale of arms to Israel. The governor of the Bank of England, Andrew Bailey and chief cashier Sarah John, present King Charles III with his banknotes. 10 April A review into gender services carried out by paediatrician Dr Hilary Cass calls for gender services for young people to match the standards of other NHS care. Five people are arrested after pro-Palestinian protestors spray red paint on the Ministry of Defence building in London. Meta lowers the minimum age for WhatsApp users in the UK and EU from 16 to 13. 11 April The Victoria and Albert Museum and British Museum return a number of artefacts to Ghana on long-term loan, more than 150 years after they were taken. The Metropolitan Police says it will partly reinvestigate its decision to charge television presenter Caroline Flack with assaulting her boyfriend because "new witness evidence may be available". 12 April Data from the Office for National Statistics shows the UK economy grew by 0.1% in February, which is attributed to increases in production and manufacturing. The British government advises against all travel to Israel and Palestinian territories due to the imminent threat of an Iranian attack. 13 April Former subpostmaster Alan Bates says he will consider raising funds to bring a private prosecution against Post Office bosses over the Horizon IT scandal.
Sources: en.wikipedia.org
== Pharmacokinetics == No clinically useful absorption of colistin occurs in the gastrointestinal tract. For systemic infection, colistin must therefore be given by injection. Colistimethate is eliminated by the kidneys, but colistin is eliminated by non-renal mechanism(s) that are as of yet not characterised.
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
Kozak consensus sequence Also simply Kozak sequence. A highly conserved nucleic acid sequence motif which functions as the recognition site for the initiation of translation in most eukaryotic messenger RNAs, generally a sequence of 10 bases immediately surrounding and inclusive of the start codon: GCCRCCAUGG. As the pre-initiation complex scans the transcript, recognition of this sequence (or a close variant) causes the complex to commit to full ribosome assembly and the start of translation. The Kozak sequence is distinct from other recognition sequences relevant to translation such as ribosome binding sites and internal ribosome entry sites.
== Series 2 == The 28-episode series 2 covers volumes 3 to 5 of the original novels. Reinhard von Lohengramm achieves almost all his goals: the Goldenbaum dynasty is finally overthrown and the Free Planets Alliance is defeated and occupied. One of the main themes is the comparison between a corrupt democracy and an efficient dictatorship and the moral issues of such a situation, with Yang Wen-li standing for democracy because a corrupt democracy can be amended, while a dictatorship can only be overthrown by force, and a wise dictator is an exception.
== Platform technologies == Rosetta Genomics has developed several proprietary technologies that enable the company to work with microRNAs. At the basis of these technologies are proprietary microRNA extraction protocols that include sensitive extraction of microRNAs from most body fluids, including serum, urine, saliva, with virtually no microRNA lost in the extraction process. The company has also developed a microRNA extraction protocol from Formalin Fixed Paraffin Embedded, or FFPE, samples. This allows extraction of microRNAs from samples preserved at room temperature. Once microRNAs are extracted, Rosetta Genomics’ technology is capable of detecting and quantifying the microRNAs using two custom designed platform technologies which utilize Quantitative Real Time PCR (or qRT-PCR) and microarrays. The company's proprietary microarray platform covers approximately 850 human microRNAs, including approximately 180 microRNAs which are Rosetta Genomics’ proprietary microRNAs. The array's high specificity allows discriminating homologous family members.
Sources: en.wikipedia.org
The synthetic peptide keeps the receptor-binding region of GHRH but carries substitutions that resist enzymatic cleavage. In the DAC version, an added group also anchors the molecule to albumin, extending its presence in the bloodstream.
The maleimide group forms a covalent link with albumin, an abundant blood protein. This attachment slows clearance, so a single administration persists much longer than the unmodified peptide. The feature is the main reason the two variants are handled differently in study design.
It is not an approved therapeutic product in major regulatory jurisdictions. It appears in research chemical catalogs and scientific literature rather than pharmacy shelves. Clinical development was limited and did not reach approval.
The mass difference from the linker is large enough for routine detection by mass spectrometry. The unconjugated form gives a single sharp signal at its expected weight. Material that has already reacted with albumin shows a much higher mass and a broadened chromatographic peak.